LocSigDB is a manually curated database of experimental localization signals for eight distinct subcellular locations; primarily in a eukaryotic cell with brief coverage of bacterial proteins. By performing extensive literature study, we compiled a set of 533 experimentally determined localization signals thus making LocSigDB the most comprehensive compendium of localization signals, to date. Each signal in LocSigDB is annotated with the protein(s) in which the experimental localization signal was reported in the literature, the exclusive subcellular location where the protein containing the targeting signal is found, PubMed references and UniProt IDs of all proteins that contain a given signal or the same amino acid pattern.

BROWSE ALL SIGNALS


SEARCH


Signal: HelpEnter the signal or regular expression pattern you would like to search as shown in following examples.
  • RRKGKEK
  • TEKK[QG]KSILYDCA (Occurrence of amino acid 'Q' or 'G' at the fifth position)
  • RRRx{11}KRRK (Occurrence of any amino acid 'x', 11 number of times)
  • KRx{7,9}PQPKKKP (Occurrence of any amino acid 'x', 7 to 9 number of times )
Location: (Optional)
Check to search the substring of the pattern. HelpThis allows user to search the signals from the database that are substrings of the queried signal or regular expression pattern.
     

Protein ID: HelpThe protein of interest.
Example RefSeq ID: NP_150241.2, AP_*, YP_*, XP_*, ZP_*
Example Uniprot Protein IDs: HNRPK_HUMAN (or) P61978
OR
Enter your sequence in FASTA format
Sequence: HelpExample of a protein sequence format (in FASTA):

>HNRPK_HUMAN
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKL
FQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFT
MMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMA
YEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF

Location: (Optional)